Solution structure of a fragment of the dimerization domain of DP-1 determined by 1H-nuclear magnetic resonance and distance geometry

Shouhong Guang, Jihui Wu, Tianning Yu, Youlin Xia, Yunyu Shi

Research output: Contribution to journalArticlepeer-review

Abstract

The structure of a synthesized peptide with the sequence of NHILPNESAYDQKNIRRRVYDALNVLMAMNIISK that corresponds to residues 151-184 of transcription factor DP-1 (Girling et al., Nature 362 (1993) 83-87) was determined by 1H-nuclear magnetic resonance in water and 40% d3-trifluoroethanol/water, respectively. Nuclear Overhauser effect cross peaks, αH chemical shifts and J-coupling constants of αH-NH show that the peptide consists a helix from Ser-8 to Ser-33 in solution. Fifty structures were constructed with 288 upper distance limits and 21 angle constraints by DIANA (Guntert et al., J. Mol. Biol. 217 (1991) 517-530). Although the N-terminal of the peptide exhibits a random conformation, the 20 best structures show a root mean square deviation of 0.89±0.36 A for backbone atoms and 1.80±0.34 A for heavy atoms from residue Ser-8 to Ser-33. This result supports the proposal that DP-1 and E2F-1 may dimerize with a coiled-coil type interaction. Copyright (C) 1998 Elsevier Science B.V.

Original languageEnglish (US)
Pages (from-to)18-28
Number of pages11
JournalBiochimica et Biophysica Acta - Protein Structure and Molecular Enzymology
Volume1429
Issue number1
DOIs
StatePublished - Dec 8 1998

Bibliographical note

Funding Information:
We thank Dr. P. Guntert and Prof. K. Wuthrich for providing the programs PROSA, CALIBA, HABAS and DIANA. We thank Dr. C. Bartels and K. Wutrhich for providing XEASY. Special thanks to Dr. Q.G. Gong for his stimulating suggestions during this work. This work is supported by the Foundation of Chinese Academy of Science and Chinese National Science Foundation.

Copyright:
Copyright 2015 Elsevier B.V., All rights reserved.

Keywords

  • Coiled coil
  • DP-1
  • Dimerization
  • Distance geometry
  • NMR

Fingerprint Dive into the research topics of 'Solution structure of a fragment of the dimerization domain of DP-1 determined by <sup>1</sup>H-nuclear magnetic resonance and distance geometry'. Together they form a unique fingerprint.

Cite this