Solution structure of a fragment of the dimerization domain of DP-1 determined by 1H-nuclear magnetic resonance and distance geometry

Shouhong Guang; Jihui Wu; Tianning Yu; Youlin Xia; Yunyu Shi

doi:10.1016/S0167-4838(98)00208-8

Solution structure of a fragment of the dimerization domain of DP-1 determined by ¹H-nuclear magnetic resonance and distance geometry

Shouhong Guang, Jihui Wu, Tianning Yu, Youlin Xia, Yunyu Shi

Minnesota NMR Center

Research output: Contribution to journal › Article › peer-review

Abstract

The structure of a synthesized peptide with the sequence of NHILPNESAYDQKNIRRRVYDALNVLMAMNIISK that corresponds to residues 151-184 of transcription factor DP-1 (Girling et al., Nature 362 (1993) 83-87) was determined by ¹H-nuclear magnetic resonance in water and 40% d₃-trifluoroethanol/water, respectively. Nuclear Overhauser effect cross peaks, αH chemical shifts and J-coupling constants of αH-NH show that the peptide consists a helix from Ser-8 to Ser-33 in solution. Fifty structures were constructed with 288 upper distance limits and 21 angle constraints by DIANA (Guntert et al., J. Mol. Biol. 217 (1991) 517-530). Although the N-terminal of the peptide exhibits a random conformation, the 20 best structures show a root mean square deviation of 0.89±0.36 A for backbone atoms and 1.80±0.34 A for heavy atoms from residue Ser-8 to Ser-33. This result supports the proposal that DP-1 and E2F-1 may dimerize with a coiled-coil type interaction. Copyright (C) 1998 Elsevier Science B.V.

Original language	English (US)
Pages (from-to)	18-28
Number of pages	11
Journal	Biochimica et Biophysica Acta - Protein Structure and Molecular Enzymology
Volume	1429
Issue number	1
DOIs	https://doi.org/10.1016/S0167-4838(98)00208-8
State	Published - Dec 8 1998

Bibliographical note

Funding Information:
We thank Dr. P. Guntert and Prof. K. Wuthrich for providing the programs PROSA, CALIBA, HABAS and DIANA. We thank Dr. C. Bartels and K. Wutrhich for providing XEASY. Special thanks to Dr. Q.G. Gong for his stimulating suggestions during this work. This work is supported by the Foundation of Chinese Academy of Science and Chinese National Science Foundation.

Copyright:
Copyright 2015 Elsevier B.V., All rights reserved.

Keywords

Coiled coil
DP-1
Dimerization
Distance geometry
NMR

Access

10.1016/S0167-4838(98)00208-8

OpenUrl availability

Full text

Cite this

Solution structure of a fragment of the dimerization domain of DP-1 determined by ¹H-nuclear magnetic resonance and distance geometry. / Guang, Shouhong; Wu, Jihui; Yu, Tianning et al.
In: Biochimica et Biophysica Acta - Protein Structure and Molecular Enzymology, Vol. 1429, No. 1, 08.12.1998, p. 18-28.

Research output: Contribution to journal › Article › peer-review

@article{3ed49fbe46e94805b89e4dd1cd4f8a13,

title = "Solution structure of a fragment of the dimerization domain of DP-1 determined by 1H-nuclear magnetic resonance and distance geometry",

abstract = "The structure of a synthesized peptide with the sequence of NHILPNESAYDQKNIRRRVYDALNVLMAMNIISK that corresponds to residues 151-184 of transcription factor DP-1 (Girling et al., Nature 362 (1993) 83-87) was determined by 1H-nuclear magnetic resonance in water and 40% d3-trifluoroethanol/water, respectively. Nuclear Overhauser effect cross peaks, αH chemical shifts and J-coupling constants of αH-NH show that the peptide consists a helix from Ser-8 to Ser-33 in solution. Fifty structures were constructed with 288 upper distance limits and 21 angle constraints by DIANA (Guntert et al., J. Mol. Biol. 217 (1991) 517-530). Although the N-terminal of the peptide exhibits a random conformation, the 20 best structures show a root mean square deviation of 0.89±0.36 A for backbone atoms and 1.80±0.34 A for heavy atoms from residue Ser-8 to Ser-33. This result supports the proposal that DP-1 and E2F-1 may dimerize with a coiled-coil type interaction. Copyright (C) 1998 Elsevier Science B.V.",

keywords = "Coiled coil, DP-1, Dimerization, Distance geometry, NMR",

author = "Shouhong Guang and Jihui Wu and Tianning Yu and Youlin Xia and Yunyu Shi",

note = "Funding Information: We thank Dr. P. Guntert and Prof. K. Wuthrich for providing the programs PROSA, CALIBA, HABAS and DIANA. We thank Dr. C. Bartels and K. Wutrhich for providing XEASY. Special thanks to Dr. Q.G. Gong for his stimulating suggestions during this work. This work is supported by the Foundation of Chinese Academy of Science and Chinese National Science Foundation. Copyright: Copyright 2015 Elsevier B.V., All rights reserved.",

year = "1998",

month = dec,

day = "8",

doi = "10.1016/S0167-4838(98)00208-8",

language = "English (US)",

volume = "1429",

pages = "18--28",

journal = "Biochimica et Biophysica Acta - Protein Structure and Molecular Enzymology",

issn = "0167-4838",

publisher = "Elsevier",

number = "1",

}

TY - JOUR

T1 - Solution structure of a fragment of the dimerization domain of DP-1 determined by 1H-nuclear magnetic resonance and distance geometry

AU - Guang, Shouhong

AU - Wu, Jihui

AU - Yu, Tianning

AU - Xia, Youlin

AU - Shi, Yunyu

N1 - Funding Information: We thank Dr. P. Guntert and Prof. K. Wuthrich for providing the programs PROSA, CALIBA, HABAS and DIANA. We thank Dr. C. Bartels and K. Wutrhich for providing XEASY. Special thanks to Dr. Q.G. Gong for his stimulating suggestions during this work. This work is supported by the Foundation of Chinese Academy of Science and Chinese National Science Foundation. Copyright: Copyright 2015 Elsevier B.V., All rights reserved.

PY - 1998/12/8

Y1 - 1998/12/8

N2 - The structure of a synthesized peptide with the sequence of NHILPNESAYDQKNIRRRVYDALNVLMAMNIISK that corresponds to residues 151-184 of transcription factor DP-1 (Girling et al., Nature 362 (1993) 83-87) was determined by 1H-nuclear magnetic resonance in water and 40% d3-trifluoroethanol/water, respectively. Nuclear Overhauser effect cross peaks, αH chemical shifts and J-coupling constants of αH-NH show that the peptide consists a helix from Ser-8 to Ser-33 in solution. Fifty structures were constructed with 288 upper distance limits and 21 angle constraints by DIANA (Guntert et al., J. Mol. Biol. 217 (1991) 517-530). Although the N-terminal of the peptide exhibits a random conformation, the 20 best structures show a root mean square deviation of 0.89±0.36 A for backbone atoms and 1.80±0.34 A for heavy atoms from residue Ser-8 to Ser-33. This result supports the proposal that DP-1 and E2F-1 may dimerize with a coiled-coil type interaction. Copyright (C) 1998 Elsevier Science B.V.

AB - The structure of a synthesized peptide with the sequence of NHILPNESAYDQKNIRRRVYDALNVLMAMNIISK that corresponds to residues 151-184 of transcription factor DP-1 (Girling et al., Nature 362 (1993) 83-87) was determined by 1H-nuclear magnetic resonance in water and 40% d3-trifluoroethanol/water, respectively. Nuclear Overhauser effect cross peaks, αH chemical shifts and J-coupling constants of αH-NH show that the peptide consists a helix from Ser-8 to Ser-33 in solution. Fifty structures were constructed with 288 upper distance limits and 21 angle constraints by DIANA (Guntert et al., J. Mol. Biol. 217 (1991) 517-530). Although the N-terminal of the peptide exhibits a random conformation, the 20 best structures show a root mean square deviation of 0.89±0.36 A for backbone atoms and 1.80±0.34 A for heavy atoms from residue Ser-8 to Ser-33. This result supports the proposal that DP-1 and E2F-1 may dimerize with a coiled-coil type interaction. Copyright (C) 1998 Elsevier Science B.V.

KW - Coiled coil

KW - DP-1

KW - Dimerization

KW - Distance geometry

KW - NMR

UR - http://www.scopus.com/inward/record.url?scp=0032421201&partnerID=8YFLogxK

UR - http://www.scopus.com/inward/citedby.url?scp=0032421201&partnerID=8YFLogxK

U2 - 10.1016/S0167-4838(98)00208-8

DO - 10.1016/S0167-4838(98)00208-8

M3 - Article

C2 - 9920380

AN - SCOPUS:0032421201

SN - 0167-4838

VL - 1429

SP - 18

EP - 28

JO - Biochimica et Biophysica Acta - Protein Structure and Molecular Enzymology

JF - Biochimica et Biophysica Acta - Protein Structure and Molecular Enzymology

IS - 1

ER -